DPCstruct | MC16616
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 185 ± 30 aa |
| Standard deviation of domain lengths | 30.43 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 67.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.32 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11526 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L7JYL8 | 1-126 | MLDRFSILYHRIQCRICALRFTDTDQGKTQYGMHIEEHNRRKRAEQHKDTISRTYFPNEDNWLSKKIELPVARQEEHKLFVSKKLVV… |
| A0A1B7SIC2 | 151-364 | PAPTAAPAPGPAVFSTPELQKLLGLNPAKALTPQPSLQQPAPASSGFVMLSIELSQVLLNNHKPTADEISLIYSSKPNQCSNCPKRF… |
| A0A2J7PVA6 | 427-608 | None |
| A0A397J4L0 | 3-176 | None |
| A0A7J7IE11 | 404-625 | None |
| T1FEL9 | 796-1023 | None |
| F1QGD0 | 1180-1405 | None |
| A0A6T6ERB7 | 13-203 | None |
| A0A6V7TQQ0 | 3-184 | None |
| A0A7S2S3S2 | 44-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.