DPCstruct | MC16615
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 502 ± 135 aa |
| Standard deviation of domain lengths | 135.05 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 69.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 17.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20222 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B7SHM8 | 133-610 | KPAESKKKRPRNSNDEDLLAPLMESRKRKKVSTRQKTPAASTAPTKRARNNTRLSSKDVMVLVRAITISQSLSPANTIDWAKVSALF… |
| A0A366PJX6 | 7-456 | LDGEDDAVVIAAFVATRTLLGGADKYIEWGLMMRLFPSRSLAFLRKFWSKTRRDRPASVKQLTERFQKRFIAAYERNEIPPLDFDNY… |
| A0A7E4RJL0 | 483-873 | None |
| F6VJA5 | 1-344 | None |
| Q0TWY3 | 263-896 | None |
| A0A0S7FM87 | 1-384 | None |
| A0A0D0UKN4 | 518-994 | None |
| A0A4T0W1P7 | 42-664 | None |
| A0A0I9R3D2 | 365-698 | None |
| L2FMS6 | 391-930 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.