DPCstruct | MC1661
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 138 ± 16 aa |
| Standard deviation of domain lengths | 16.04 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 30.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10166 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3D603 | 2-121 | GNAVASSVGNKMKESMQESQAVMMEKQKAMQMEMIKRQRAIGFAQAKDRFEWYSAFVSTVAVLGVIGALKTKKPTPLVPMVPLGFLL… |
| A0A7R9FZD2 | 94-228 | SNVRQASELLLNYLTGKVERQIQMQNQMRERMVSMQVARARELLYWFGSFYILAALGMIAGFRRTRKPGVLAPLLPLSFIGGYQADM… |
| A0A4U8UQD9 | 21-144 | None |
| A0A6P8IP17 | 2-145 | None |
| A0A498MFA2 | 51-187 | None |
| A0A7S3PS65 | 6-138 | None |
| A0A0N5A2U1 | 2-127 | None |
| A0A7S3CHX9 | 3-182 | None |
| E0VME7 | 12-157 | None |
| S7MKI9 | 74-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.