DPCstruct | MC16608
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 96 ± 8 aa |
| Standard deviation of domain lengths | 8.05 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 68.99 |
| Pfam Score | 97.06 |
| Assigned Pfam label(s) | PF06792- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453RH78 | 102-197 | KSILHKLKQQIGEGIPIIGAGAGTGISAKFEEAGGVDLIVLYNSGRFRMAGRGSLAGLLPFADANAIVLEMANEVLPVVKEVPVLAG… |
| A0A804N526 | 202-301 | EILRRTWSILHKPKEQISDGTPVIGAGAGTSISAKFKEAGGVDLIVLYNSGRFRMAGRGSLAGLLPFGDANDIVLQMASEVLPVSSS… |
| A0A6G1DWB2 | 289-383 | None |
| A0A453RH04 | 466-551 | None |
| A0A2T5M1Q4 | 7-103 | None |
| A0A0F8WTX0 | 486-582 | None |
| A0A445EX67 | 512-611 | None |
| A0A212DP95 | 9-92 | None |
| A0A5A7VCS5 | 167-256 | None |
| A0A7J0EUQ5 | 432-527 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.