DPCstruct | MC16607
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 72 ± 2 aa |
| Standard deviation of domain lengths | 1.84 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 86.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 88.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0124 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453PDW8 | 78-150 | KPGPVVSEAMFVNREEIPVYPLYRDPVHDFGFFRYDPGAIKFLKYEEIPLDPEAASVGLEIRVVGNDSGEKVS |
| A0A804N0J9 | 1-76 | MLAMTGPVVAEAMFVNREEIPVYPLYRDPVHDFGFFRYDPGAIKFLKYDEIQLAPEAASVGLEIWVVGNDNGKNVP |
| A0A5B6VYV6 | 96-166 | None |
| A0A4V3WLS1 | 92-161 | None |
| A0A822YMA8 | 94-166 | None |
| A0A7J7I8X9 | 253-325 | None |
| A0A804P9E2 | 277-347 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.