DPCstruct | MC16606
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 137 ± 12 aa |
| Standard deviation of domain lengths | 12.26 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 45.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7CXQ7 | 44-173 | WSVGVVMLELILGSPNVFQISALTQSLLDQHIGGWKEELKELAYRLRSFMELCILIPGSSSKHHRVTNDGGVSPASWKCSEEFFSNQ… |
| A0A804MVG9 | 1-130 | MLELMMGSPHVFQISDRTRILMDQHLGGWSEQTKELAYKLRSYMELCILVPGISSQHHGSGSPEQGQFGLASWKCSEESFAHQVKIR… |
| A0A7S1ZVC0 | 40-190 | None |
| A0A059A6X3 | 694-810 | None |
| A0A067JN03 | 538-672 | None |
| A0A453SHM6 | 330-463 | None |
| F0X0Q1 | 105-254 | None |
| A0A0G4IHL1 | 319-465 | None |
| A0A7J6WIB3 | 605-741 | None |
| A0A0K9Q3P8 | 833-952 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.