DPCstruct | MC16605
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 82 ± 5 aa |
| Standard deviation of domain lengths | 5.39 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 77.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 56.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03937 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I0YN77 | 35-113 | MDDSQLAAMETVLDQENPDLFKWLTGQEEAPQAMQANPAFVDMKHNVEERLAAHRDNAAMSQPGKDWVRGWDDWNSSPG |
| A0A804MUX3 | 1-79 | MDEPNIRALLQVLDLENPDLWKWLTSQEQPPEDLISNPVFSAIKSKVTDNLIKHASPETRSTPGQPWVRGWDDIKKGKD |
| A0A059AYV6 | 107-185 | None |
| A0A6P5TP17 | 75-163 | None |
| A0A7S0R4C6 | 91-171 | None |
| A0A4Y1RH22 | 478-566 | None |
| A0A6A2ZRE6 | 237-315 | None |
| A0A498JJ28 | 90-178 | None |
| A0A4D8Y975 | 25-96 | None |
| A0A150GTQ2 | 52-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.