DPCstruct | MC16603
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 87 ± 8 aa |
| Standard deviation of domain lengths | 8.25 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 75.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 70.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0116 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A446IWI3 | 94-170 | LGAGEGAPLDLAALDGTWRLCYTSASDVLMLFEAAERLPLLQVGQIYQKFECKGRSDGGIVRNVVRWSIENLLEWSI |
| M8AY82 | 1-86 | MEVSVEELGAGEGAPLDLAALDGTWRLCYTSASDVLMLFEAAERLPLLQVGQIYQKFECKGRSDGGIVRNVVRWSIENLLEVSQVI |
| A0A2U1N310 | 180-262 | None |
| A9SJC5 | 66-153 | None |
| A0A7J8M6G4 | 1-101 | None |
| A0A1Z5S6U6 | 100-184 | None |
| A0A452YLU3 | 40-116 | None |
| A0A067H4F7 | 1-100 | None |
| A0A452YLV6 | 39-115 | None |
| A0A452YLV0 | 18-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.