DPCstruct | MC16601
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 156 ± 12 aa |
| Standard deviation of domain lengths | 11.59 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 78.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 52.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A804MFX7 | 1-165 | MLAARNRSVLSQGSRSYKSAKVAAKRLEEAALSCKGDERVQLLRRWLVTLKETQRATTVVRELQLGDNPDQTAPLLDLYIDYDSGAE… |
| A0A287P7D6 | 1-141 | GNRYYKSLKLTAKRLEEAALSCRGEERVQLLHRWLVGLKETEGAASSMPADGPNQAAPVLDLYVDYEKADEPMTFFHVFLYSQALEC… |
| A0A835RQA0 | 51-197 | None |
| A0A452Y337 | 1-150 | None |
| A0A804U6N1 | 35-190 | None |
| A0A453EC54 | 38-207 | None |
| A0A7J9HVS2 | 2-130 | None |
| A0A446N8N5 | 55-209 | None |
| A0A3L6EMK9 | 1-161 | None |
| A0A1S4CZH6 | 49-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.