DPCstruct | MC16600
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 297 ± 27 aa |
| Standard deviation of domain lengths | 27.48 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 70.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 45.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A804MDX2 | 1-287 | MSMESPVVLRSTKALLDRLEKRLVISHSVASSSVENVDHLLKRLGSPPRRRAPPSREGKTRAVVKRPAKSSEASIKLPRYSLRVVLC… |
| A0A378J510 | 48-309 | TALESSRYVHDMISLAQARQDSFPQLEKFILAPETLKTTRQLLMHLEQAKDLIVPSRMSVSNVYQAERQFLAAYMIVSKSKFLFEAS… |
| A0A0A0KGG6 | 352-640 | None |
| A0A314YZK4 | 319-674 | None |
| A0A2G5DBM5 | 11-300 | None |
| A0A438BVL3 | 6-317 | None |
| A0A2T7CV65 | 8-292 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.