DPCstruct | MC166
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 108 ± 11 aa |
| Standard deviation of domain lengths | 11.00 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C1FN64 | 5-94 | GQSFSNLKQTCLELSTLNIKLNPLKDGALTKGNVSYVLFDDKRNEAEIFLPFQDKGIVLKKTAEGNWSNGEYKLIAWKGYVLQKSGK… |
| A0A496LV04 | 1-101 | MVGGGTDEHGCLVAAGQSFSKIKNGCVQVFDVADVRLDDPDNATLAIYGIFSADKSKVEIFWASLPQSEILSKVKGGYYVSKDGKIS… |
| A0A1I1NR27 | 11-130 | None |
| A0A841I259 | 119-218 | None |
| A0A2R3ETK6 | 32-133 | None |
| A0A4Q2UI38 | 29-156 | None |
| A0A1Q6H4G6 | 131-230 | None |
| A0A645ISW6 | 1-105 | None |
| A0A7W3VGL3 | 46-156 | None |
| A0A7D7S7Z3 | 96-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.