DPCstruct | MC16599
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 163 ± 17 aa |
| Standard deviation of domain lengths | 17.24 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 56.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P5FNP2 | 46-193 | GDPGMRRDGLRVAWEAWNFCNEVGAEAPLMGSPRGADCFDLLQDESGGSGDKVVHRVSEKDNKLSVGDPFSGEEEEKESITNVDLYA… |
| A0A804M7H6 | 1-184 | MPSCPAPAPAVATFLLVALLSCGTRAIRTHGGYVSAVGDPGMRRDGLRVAWEAWNFCNEVGQEAPGMGSPRGADCFDLLETSSDEEG… |
| A0A7G2DWP6 | 31-184 | None |
| A0A061DRJ1 | 11-182 | None |
| J3M5F3 | 1-185 | None |
| A0A834LLT3 | 381-524 | None |
| A0A0D9ZWJ7 | 1-180 | None |
| A0A2R6XK68 | 134-280 | None |
| A0A7J0G121 | 1-134 | None |
| A0A835ARK9 | 237-413 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.