DPCstruct | MC16597
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 99 ± 8 aa |
| Standard deviation of domain lengths | 7.78 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 93.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 38.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B0Y0Q1 | 21-115 | YYQDIFTYWDLFRCSTALMQVLQPTAYEEQIRSLIDIWRFEGYLPDARSSNYNGRTQGGSNADNILADAYVKGVRGAVNWEDGYKAL… |
| A0A1Y4GMU4 | 447-560 | YYDDYYAIWDTFRATHPLFTLLTPSRQADMVRSMIDIYEHEGYMPDGRSGNCNGRVQGGSNSDILIADAMVKNLPGIDYEKGLAAMI… |
| A0A5M3MT55 | 141-236 | None |
| A0A1E1M5H5 | 24-115 | None |
| A0A433DFS1 | 213-309 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.