DPCstruct | MC16594
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 78 ± 11 aa |
| Standard deviation of domain lengths | 10.54 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 42.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C3QBM5 | 48-123 | NRAHVLQECPDHLGHQWILRKASEDISLPEILGTPKGIKALAKFLKATGAFTKAGRPLPASDLPIYKDEPEPKADP |
| A0A0L6WUM3 | 1-77 | MDQTREHIFQTCPKYEAYRYILHEANEQLDLGILLGTKDGLKATAKFLEKSGAFTKTGTKQQQNKKPTEYDDENNED |
| A0A0C9ZY91 | 27-87 | None |
| S8FQJ7 | 30-125 | None |
| A0A550BS13 | 29-89 | None |
| A0A369J836 | 193-270 | None |
| V2WQ91 | 1-85 | None |
| A0A4Y9YE99 | 23-106 | None |
| A0A409XQS0 | 106-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.