DPCstruct | MC16592
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 269 ± 21 aa |
| Standard deviation of domain lengths | 20.54 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 65.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.89 |
| Mean length-normalized TM-Score | 0.27 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A381L9B8 | 1-267 | MNQSSYQRSTRRNIYDGDDLDQLAVDPSRLHYGRRNDPRTAEMLLNDRALAPSKATIFNTLAAFNLDDDERDDTYDISDVGGLVESA… |
| D8PWW2 | 1-238 | MNTAQLRVGKKNDDVLRDREFISQMKADILRRAEAMDLEDEEEEDVEKAADAFEDDLEGLNQVKVAGDGEETDEEEDAAPPTPDTIL… |
| A0A4U0V2U3 | 110-362 | None |
| A0A6G1LQY3 | 23-313 | None |
| A0A229Y7E8 | 221-511 | None |
| G3AL97 | 132-382 | None |
| A0A2J8BY61 | 179-438 | None |
| A0A0F7SIT4 | 390-686 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.