DPCstruct | MC1659
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 189 ± 32 aa |
| Standard deviation of domain lengths | 32.29 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 24.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A6UDH6 | 1-195 | MEDTLALPDAWRRQVHPRRGGTVVRPFAADPQAPERAGRMLAERQARVSAVLAAPSTTDDVRAAATRWQAGEADPLGAAAVAVITGQ… |
| A0A076EWN6 | 37-205 | RVPSGWWRRAEVFRGRTPKRKVSLDAGASEAVDALIVRAGAEFERTISHPATLVDLAVAGRSFLEGRAGGDGAVNVVGAAVAWLVLT… |
| A0A7W9P1K3 | 11-224 | None |
| A0A6I4M6C0 | 8-175 | None |
| A0A345XSA4 | 1-193 | None |
| A0A376SI87 | 91-316 | None |
| A0A4R4ZZP7 | 12-169 | None |
| A0A1Q9T420 | 1-213 | None |
| A0A6H9Z5E6 | 10-174 | None |
| A0A1G5LX44 | 98-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.