DPCstruct | MC16589
Metacluster Properties and Pfam Annotations
| Number of structural domains | 122 |
|---|---|
| Mean domain length (aa) | 97 ± 15 aa |
| Standard deviation of domain lengths | 15.41 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 88.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.43 |
| Pfam Score | 96.75 |
| Assigned Pfam label(s) | CL0010- CL0098 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C3DCG6 | 78-182 | NDQLRILDPTRARTNLFSKGNPEGAKVGDILLVRLKDGEPFAGVCINIRRRGVDTGILLRNQLTRVGVEMWYKIYSPNVEGIEVVQR… |
| A0A831KZQ9 | 48-146 | QTPRDDLPRIRTGDIVAVHYRVIEGGKERIQVFEGTVIAQNNRGISRTVTVRKTSFGVSVERIFPLNSKLVQTIKVNRHSRIRRAKL… |
| A0A2U3EJR9 | 158-247 | None |
| A0A7C6E3X0 | 1-72 | None |
| A0A0G1MYG9 | 1-69 | None |
| G0QLQ5 | 161-265 | None |
| A0A7C9KCM8 | 10-113 | None |
| R7TP34 | 89-197 | None |
| A0A0B1PJD4 | 75-176 | None |
| A0A044UZ17 | 915-1014 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.