DPCstruct | MC16588
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 91 ± 6 aa |
| Standard deviation of domain lengths | 5.89 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 31.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I1J879 | 25-116 | RKSLVEEFDHLYVYNLRGNARTSGEQRRKEGGNAFEQGSRATVAIMLAVKDPAQQGDCVLHYRDIGDYLSREEKLEIVDASDVDTIE… |
| A0A6P0HX02 | 333-425 | RKCLVDEFTSIYCFNLRGNQRTSGELSRKEGGKIFGSGSRATIAITLLIKNPGKKQESKLFYYDIGDYLSRGEKLNIIKHFGDISTI… |
| M5YGQ0 | 787-878 | None |
| A0A7I9WDP9 | 35-118 | None |
| A0A0M1J4B9 | 95-187 | None |
| A0A6B0ZX10 | 448-535 | None |
| A0A438P1E5 | 2-73 | None |
| A0A4U8TPN2 | 871-971 | None |
| A0A1J5QAS0 | 328-430 | None |
| A0A838L135 | 150-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.