DPCstruct | MC16586
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 138 ± 20 aa |
| Standard deviation of domain lengths | 19.60 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13660 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M2GM65 | 14-146 | FQAGLNRADPYQMVIDTVRLEGDQLHLRTDTGPLEVDLAQFDRIVILGWGKASARMAHALETILGDRISEGLVVTAYGHTASLNRVK… |
| A0A7X5W581 | 4-142 | DVLEKIIYHALAKVDPCRLVPDNLRLEGNRLYIKDQWFDLDRFDKVHAVGVGKGAPFLFEGLDSVLGSRIDGGVIVSLEDHAFNHDR… |
| A0A136KYL4 | 38-167 | None |
| A0A1K1V5J2 | 1-81 | None |
| A0A1I8I6I4 | 16-200 | None |
| A0A2C9JCZ5 | 83-245 | None |
| A6TL35 | 345-460 | None |
| A0A7W6C6G1 | 6-137 | None |
| A0A814V4E2 | 16-131 | None |
| A0A6L5D8K4 | 45-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.