DPCstruct | MC1658
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 74 ± 10 aa |
| Standard deviation of domain lengths | 10.43 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 46.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A6UA59 | 3-70 | RAGEVIHVGAAASVQFAGNRALTFRVIRIDPRITYDGWLWIDGYVLGPTGEATERRVIFVKRDGLRRI |
| A0A7K1GXE6 | 2-62 | LWLTRAASPQFYRPIRFRLIKKLDLTTYDGWIWLEGYQVDDRGDAIARRAVFVREQGLRKL |
| A0A6F8Y3J6 | 1-74 | None |
| A0A1C5A583 | 103-171 | None |
| A0A562WNP6 | 21-97 | None |
| A0A810LQS7 | 9-92 | None |
| A0A810KUH4 | 11-97 | None |
| A0A2N7SW91 | 34-107 | None |
| A0A4R4SP83 | 2-79 | None |
| A0A561VVU4 | 2-50 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.