DPCstruct | MC16579
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 147 ± 26 aa |
| Standard deviation of domain lengths | 26.25 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 44.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P5ASA2 | 1-122 | MIIRDHRRECCSVVEKIFGQGPSMEGDFIVINFFALEGWSLAELFRVRCIVAAPYVVPYSAPSSYERHFKKEHPLLYEYLQEAPTHK… |
| A0A2U1MR44 | 79-214 | TSGSVPFTFCEEKRRITREHRQECVVIFEDIFGDVPVMEADLVIINFFALEGWSLAELFNVRCVIAAPYVVPYSAPSSFERKFSEEL… |
| A0A6S8JD36 | 1-143 | None |
| A0A2K3PRN7 | 73-231 | None |
| A0A0N7KEX0 | 5-146 | None |
| E1ZCP7 | 276-480 | None |
| K3YU09 | 2-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.