DPCstruct | MC16577
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 616 ± 84 aa |
| Standard deviation of domain lengths | 84.10 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 30.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453NQE6 | 1-497 | QNHRQIISLLEFVRYDYLPQIQQCSIKIMGILSSRIVGLVQLLLKEDVAKSVIEDYAACLEFRFDDFQVIENTKDDVGVLILQLLID… |
| A0A016RS97 | 36-558 | ALLAQILNDTPVYRAICSVLLEDVNIQDQTTRTSRRTSAPALPAIELLSIAISRYASLKASIRSTDSDVMLAPLHTLLLSPLQPSGL… |
| K7KWK9 | 718-1421 | None |
| A0A835RE33 | 1-652 | None |
| K3X5U5 | 249-1005 | None |
| A0A0B1PLZ0 | 195-720 | None |
| A0A0P0VG25 | 79-755 | None |
| A0A811W8A3 | 15-571 | None |
| A0A1D6H3M4 | 660-1355 | None |
| A0A453NQZ8 | 12-564 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.