DPCstruct | MC16575
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 220 ± 29 aa |
| Standard deviation of domain lengths | 29.46 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 44.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B6LJC7 | 356-605 | LYEVDAMDCPEYGCSRSSTLLEKLRPEFRLKHGINSFRDRHMWTINDMIKRKLPAEYSKRRSRQMDKWLCKLISSKPYFKHSDERQS… |
| A0A453NMA7 | 1-244 | DEFQRYLPAYMEMLEQVDSMDVSDERDYLKEEALLQKLRPEFRSKYGINSCEHPYMLTISSLRQQQFYSMNGLIYQREKNKFLSKLI… |
| A0A0A9V157 | 1-183 | None |
| A0A0A9U0I9 | 1-272 | None |
| K3ZMF1 | 340-522 | None |
| A0A368RTM5 | 730-966 | None |
| A0A287M081 | 481-718 | None |
| A0A811QJE7 | 634-851 | None |
| M8ARF4 | 87-275 | None |
| A0A453GCZ1 | 169-373 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.