DPCstruct | MC16574
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 112 ± 10 aa |
| Standard deviation of domain lengths | 10.15 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 51.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0037 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453NLE7 | 1-111 | QLVYWDSKVSVEDLDGMWSQPDVLKEWTNSGERRGNVRFSHDAKKRPYLSRVEVKAVAEIIISRHFSSRGVKPEALAALAEVCSMRF… |
| A0A835QBC8 | 7-121 | YWDDCVDPEDMQLMWHDVDVCKEWSDAGERLGQRVHLSRDPDGQTYVTQTEMRVVSRIIVDKHFKSQLDPDMLCALAEILSDRQLLA… |
| A0A287TTI3 | 44-154 | None |
| A0A7J6W7Z1 | 209-333 | None |
| A0A2I0KAH4 | 2-96 | None |
| A0A1D6QSC0 | 109-222 | None |
| A0A1E5VB66 | 120-234 | None |
| A0A0D9VCQ2 | 3-110 | None |
| A0A4S4ETA8 | 137-227 | None |
| A0A7J6H381 | 126-234 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.