DPCstruct | MC16572
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 205 ± 31 aa |
| Standard deviation of domain lengths | 30.53 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 49.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453NLC0 | 2-177 | CYIMNVATPTKDCLELTYELLLPVIKARDDRTLTRQERSILLDCEDRINVLLAIVFENYKSLDEHSITGLSELFGPISDCAAPALAP… |
| A0A453NL26 | 1-176 | MCVQRSILLDCEDRINVLLAIVFENYKSLDEHSITGLSELFGPISDCAAPALAPAVQIFSVLHDILSNEAQSILRSYLQAAAAKRCR… |
| A0A2I0VRU8 | 530-761 | None |
| A0A2P2IK55 | 4-214 | None |
| A0A7J0FG32 | 215-448 | None |
| A0A816JE65 | 2-172 | None |
| A0A453PLP2 | 2-202 | None |
| A0A150G7P3 | 289-544 | None |
| A0A5A7QKW9 | 124-332 | None |
| A0A287USM4 | 61-295 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.