DPCstruct | MC16571
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 128 ± 12 aa |
| Standard deviation of domain lengths | 12.02 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 75.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 51.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A438JGS5 | 490-621 | FPESQGDALLLEVQDAKKSVQGRCTIPISSLSDNPSERIRWWSIFHDDHECVGKVQLSIGSTITFDETNHIKSGAVVETLAYDLLLE… |
| A0A453NKX2 | 1-126 | GDVILVEVQDNNRVVIGRAEIQVSSFSDAHQEEFTRWWPLYLEDQECVGKIQLCLNLSMPADNYGSAKMLQGGLAVDTIIYDMVLEA… |
| F6GZ56 | 134-255 | None |
| A0A7J7LXU5 | 1-105 | None |
| I1P4H4 | 120-256 | None |
| A0A287USM4 | 1-121 | None |
| A0A453NKW1 | 1-137 | None |
| A0A251V585 | 1-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.