DPCstruct | MC16570
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 52 ± 3 aa |
| Standard deviation of domain lengths | 2.91 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 53.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K1R4R2 | 18-70 | VKEVELMRALKVAFWCIQDEVFMRPSMGEVVKMLEGSMDINTSPMPQTVLELI |
| A0A453NKJ2 | 1-53 | VRAEELERACRVACWCIQDQEAHRPTMAQAVQALEGVVHVDMPPMPRTLQNLT |
| A0A7J7MLI3 | 48-104 | None |
| A0A7J7LHY3 | 44-95 | None |
| F6H5E1 | 157-206 | None |
| A0A2P5DNM0 | 29-78 | None |
| A0A0N7KKS6 | 412-465 | None |
| A0A438ID02 | 22-76 | None |
| A0A540L6M9 | 48-99 | None |
| A0A453G683 | 1-56 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.