DPCstruct | MC1657
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 257 ± 44 aa |
| Standard deviation of domain lengths | 44.39 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 34.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A438XQK6 | 1-274 | MVKEKSLELPLGHPLVEKLCDLSLKDGVKFNEKSEPNFKKEVLEEDKIKFKQALRVLHAIVNNETSLRYLSDENQKFIEDLAQAEKI… |
| M3QX34 | 337-612 | MVEERSLKLPLGHPLVEELCDRSLKDGVKFNEKSEPIFKDEVLEEDRIKFKQALRVLHAIANNSASSRYLSDDNQKFLEDLAQAKKI… |
| A0A839ITI5 | 10-190 | None |
| S2ZTC0 | 244-463 | None |
| A0A4R2RFH8 | 196-427 | None |
| A0A1S9CJR7 | 189-396 | None |
| A0A839IX10 | 185-380 | None |
| I0X5U8 | 44-373 | None |
| F4D305 | 5-278 | None |
| F8KT47 | 34-345 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.