DPCstruct | MC16568
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 133 ± 15 aa |
| Standard deviation of domain lengths | 15.06 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.55 |
| Pfam Score | 60.95 |
| Assigned Pfam label(s) | PF06883- CL0410- PF04563- PF04567- PF04566 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| O28392 | 4-117 | CRVYINGALVGFHDNGEELANKIRELRRKGRISNQVNVVYYPDSNEVRINTDAGRARRPLIVVKDGKPLVTPEHIEKIKKGELTIED… |
| A0A453NI65 | 1-129 | EDLSLLSGEEIHAPGSFLVMFNGLILGKHRQPQRFANNMRTFRRSGKIGEFVSVFVNEKQHCIHIASDGGRVCRPLIIADKGRSRVK… |
| A0A6C0JBE8 | 467-559 | None |
| A0A2A2KTH8 | 407-541 | None |
| A0A1P8BFS9 | 523-658 | None |
| A0A438DLU3 | 20-173 | None |
| A0A1A9VXS4 | 2-149 | None |
| A0A835Y177 | 602-735 | None |
| A0A5E4QCT5 | 2-121 | None |
| A0A6A2XBF3 | 697-842 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.