DPCstruct | MC16567
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 248 ± 60 aa |
| Standard deviation of domain lengths | 60.06 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 75.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 28.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B7GQ80 | 18-185 | LQVGNNRVWDYVRDNYVHRLLQSEGDGKVVSYERMSPVADTKEEVIQGEEKLTALQLEYTHLLSTQLESQRQFFENKIAEAQANALQ… |
| A0A453NHB3 | 29-240 | HAIEHWKETEHCYSLELETQKVWDYAGDNYVHRLIQSKTDGKLVEYNCYGGHEADGICSICSGDAGMDEALLNSKVEAIVEEYNDLL… |
| A0A1I8F5P7 | 690-941 | None |
| A0A7E5WK74 | 250-549 | None |
| A0A3Q0J6N8 | 54-204 | None |
| A0A0V0QQI9 | 141-308 | None |
| A0A0V0QSM1 | 13-183 | None |
| A0A7S2RFQ0 | 1-297 | None |
| A0A164W4G8 | 237-440 | None |
| A0A0N1PHU3 | 210-512 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.