DPCstruct | MC16566
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 121 ± 17 aa |
| Standard deviation of domain lengths | 17.43 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 74.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 29.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P3Y9P8 | 118-223 | LESPFCCDLITPYKPTRTARDAVFEDFRHGRGHHPNILIEVKRQVNNGPMMSTRYFTLEGGTRLEVPEPASHRKLHSYKNYKCPEHD… |
| A0A6A6VLR0 | 4-120 | LAMTLSHESLFRTFKDWADYPRSTEISSSPPTNDPAHVIQVVKQVNFGPLESKRYFAVNGDECVEVEEKWLIENNFQKLNAFKNFKC… |
| A0A6A5Q874 | 14-122 | None |
| K9FMY2 | 12-138 | None |
| F4PQZ8 | 97-210 | None |
| A0A146FM57 | 1-99 | None |
| A0A194XJU8 | 10-163 | None |
| A0A094KBE3 | 5-143 | None |
| A0A2J6TAP2 | 1-166 | None |
| A0A135LL63 | 11-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.