DPCstruct | MC16560
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 163 ± 13 aa |
| Standard deviation of domain lengths | 12.83 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 70.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A329SFJ9 | 61-209 | YNPEAPVDTEAAYAGRKLIDRHVEPPHVAYLVEWNCRPCQLSWEWAENLKNVYWCMNQVNKWKAATSDLSFNTFYGSNFRGAGALEE… |
| V9FE11 | 1-178 | MYWRIYGNNYDRSKLTVTANYASTKEKWQVARINDRRGDSLLEYKYQVLWVNPLVKRRRYYQRTWEPCVQLLGDEFRKEIELMDRWK… |
| A0A329R916 | 2-141 | None |
| A0A833T9N7 | 2-158 | None |
| A0A6A3QL76 | 2-161 | None |
| G4ZXH8 | 46-215 | None |
| A0A2P4XG42 | 115-281 | None |
| A0A6A3LGE1 | 29-191 | None |
| A0A225VNP0 | 27-213 | None |
| A0A6A3YKH4 | 81-240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.