DPCstruct | MC1656
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 113 ± 16 aa |
| Standard deviation of domain lengths | 16.25 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0491 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A438MYA8 | 94-180 | MSRQDIIHAYRNLHKATLKAICYSKPASHTARSILNDTFRKRPQDDFDAIRIQNTLKFLQAAADYAGYEHKILKNLLYVKWWQSHES |
| S3DLA6 | 5-95 | TAIEVIHAYRHLYRGLLHGVQFSKPARYIARDTLREAFRSDPPSMFNQKRIDNTVEFLGYAAKEAGLEHKILRNLLFKKSWERRYGL… |
| N4V8E3 | 1-121 | None |
| A0A167VWF1 | 1-113 | None |
| A0A2H3A2F4 | 18-118 | None |
| A0A178F4S8 | 445-576 | None |
| M2N9R2 | 2-116 | None |
| A0A0E9NNH4 | 1-115 | None |
| Q872S4 | 1-101 | None |
| A0A7C8L089 | 25-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.