DPCstruct | MC16558
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 207 ± 27 aa |
| Standard deviation of domain lengths | 26.93 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 55.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W2ZJC9 | 638-878 | YRILMLRRSYISCKRYGKRCDRLCENLRLNDAVVYVQESMRLSAYDARNYHRVALLYLLVEGLMGDLFLLIAQEGIIGRLQYISLGY… |
| V9EQE5 | 41-235 | FRGLIIRRSYISCKRYGDKCDRMEVKLGRKSATIFVHESLRLSAHGASNYHRVLLLYFLLEGLMSDLFLLAATDGSFTWIQYVSLGY… |
| W2IJB1 | 953-1168 | None |
| W2LFM1 | 246-459 | None |
| W2LHV7 | 13-192 | None |
| A0A0W8C7D3 | 21-235 | None |
| A0A0W8C1F2 | 2-175 | None |
| W2YU19 | 246-458 | None |
| W2GFP0 | 183-413 | None |
| A0A662XNE3 | 660-899 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.