DPCstruct | MC16557
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 304 ± 39 aa |
| Standard deviation of domain lengths | 39.28 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y5F4P3 | 4-304 | SAILNITFCNHENRAKTKVLKWNIEQHPAALLWLKLLKNYLIQSQSIHTRFNGFIHGYRDKDFLTLKLNNCIEIINKWDFYKEVIPH… |
| A0A1Z9TA10 | 2-302 | KLKIILQSEFGGKQKTLDFDLYQKPIVTKVLELLDRAKQDVHSSIDFRIDSKQKQSDQTSLELAMEMNRIIDTVNSLDCVTIPDSCY… |
| A0A2E3XQP6 | 2-290 | None |
| A0A7S3THR1 | 88-480 | None |
| A0A2E6ZIL8 | 3-357 | None |
| A0A418W8X0 | 64-392 | None |
| A0A3C0GDK6 | 4-301 | None |
| A0A1Z9B2E3 | 1-274 | None |
| A0A2E2UC48 | 2-288 | None |
| A0A2E2UBK7 | 102-369 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.