DPCstruct | MC16554
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 111 ± 7 aa |
| Standard deviation of domain lengths | 7.42 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 24.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F9HP64 | 12-118 | YQNLDLSVLDRLMVAELLPARQDITMLRLIRVFRESLSFSQEELAILDFQPGPENQGLQWKDEGAARVGIKRVSVPVAIYLDLQEKL… |
| A0A644UF18 | 1-107 | MKSIMIKLNIKERVILPEILPQQGSKLQQIVVRSLLAKIEFTPAEIKSFEMNFTAKGISWNEKALSEKFSVELSEPEVSVLKEAAAA… |
| A0A413NP00 | 29-145 | None |
| A0A0F9WLE0 | 5-124 | None |
| R5BWL9 | 1-107 | None |
| A0A0F9NX29 | 18-134 | None |
| A0A6M3KHC3 | 2-96 | None |
| A0A0F8WLM0 | 1-118 | None |
| X1TYU0 | 27-143 | None |
| A6LAF6 | 1-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.