DPCstruct | MC16551
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 182 ± 23 aa |
| Standard deviation of domain lengths | 22.54 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 47.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A542E2D2 | 12-174 | SPLHGPGLTARLGVWLAAAFLVCFVTGVVSHLQQDPVAGLVLPTGPAWGYRVTQGLHVVTGTASLPLLLAKMYAAYPRLFERPLLGG… |
| A0A1V4A5Z2 | 2-198 | LPQTPPPGPTRPGFWRSPLRGPWLTSVFGLVLLVGIALMFVSGLVSYAAYNPDLAVGNDKTPDKGLLGFYLFSWPTRPYWLYRLNQG… |
| A0A852X857 | 18-195 | None |
| A0A1N7DLM2 | 87-256 | None |
| A0A6B2YIX3 | 1-190 | None |
| A0A1G8BD49 | 18-188 | None |
| A0A7I7QM31 | 2-150 | None |
| A0A498PQ19 | 264-489 | None |
| A0A4D4LGU7 | 17-213 | None |
| X8CTI1 | 3-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.