DPCstruct | MC1655
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 110 ± 11 aa |
| Standard deviation of domain lengths | 11.27 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 33.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2B7P4 | 313-404 | MGCFVCAPVPGQNECHPTTSCAPTPFGTMCLTRPGYKADGVADNDVKVQWRMKWPVPGHEHRVAVKPGTSANTLCDPQNTGPDVCKE… |
| S3DET3 | 219-330 | IPCADCNSPSETTTPTTQPNPSNCPAACNPHPGFPYQCDITAPCSNAGSYTYCACRAGYRASGLSVDDPRQARFESAEGTFRVHVAP… |
| A0A6A6SG43 | 65-176 | None |
| A0A6A6X3A5 | 335-456 | None |
| A0A6A6HWP5 | 428-531 | None |
| A0A1Y2A9K5 | 225-345 | None |
| A0A6A5Y6X9 | 1080-1197 | None |
| A0A179UZV6 | 606-697 | None |
| A0A6A6NLZ1 | 8-128 | None |
| A4D962 | 1053-1144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.