DPCstruct | MC16549
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 259 ± 45 aa |
| Standard deviation of domain lengths | 44.93 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812CGM1 | 11-185 | FLLSPTNECGIEKFVCTTIRPTVLPFPEIYEWDAAASFVADYLVCEMLEPTFELPDRILSPSTVLKRQKGNCFEYSMLLCSLLLGAG… |
| X6NJB8 | 3-277 | IFNTNELNTSKPMAITIETFDQTQLISKYEYLKKMRESKYPNENFKNSFDEIHILEYAECFRRQFVQLFPKRPDLLLSAQNEFGIKV… |
| A0A7S4U8L7 | 66-396 | None |
| A0A1Y2HNU3 | 15-274 | None |
| A0A662X5S7 | 59-334 | None |
| A0A1I8N926 | 21-374 | None |
| A0A484C0Y7 | 5-280 | None |
| A0A7S0R7H1 | 330-604 | None |
| A0A5A8CLH0 | 39-356 | None |
| A0A7J5ZJ17 | 2-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.