DPCstruct | MC16548
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 180 ± 15 aa |
| Standard deviation of domain lengths | 14.63 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 30.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F6UHX8 | 1-177 | MTFTDMNDWIGSRYLREMAAIDNLSSVVRQCIEEGVQLEYELLLEQDEFIINHDAKVIRTPSPPPRPEPIETSQPDVFTIVQLGKLY… |
| X6NGR1 | 1-229 | MSKLDEWIRLRIASEDEAIQSLILYVQDNIEQESPLYHRLLLNSDNVLIDNDLLLHPLPAPIKQSVQMEQELEGAFKISQLRKIQSS… |
| A0A7S4PBY1 | 296-470 | None |
| T1FRF5 | 10-182 | None |
| A0A498P2H4 | 609-781 | None |
| A0A2G8L0A4 | 72-245 | None |
| A0A7S4PCD6 | 69-238 | None |
| A0A340XKH4 | 239-412 | None |
| A0A7S1KTK4 | 885-1063 | None |
| A0A653DPR4 | 414-582 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.