DPCstruct | MC16547
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 133 ± 13 aa |
| Standard deviation of domain lengths | 12.95 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0131 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A100I0K6 | 9-140 | YWLGRLVLERGVAAVYLTAFVASALQFRALIGEHGMLPVPRYLAHRSFWRTPSVFHFRYSDRLCAGVCWLGAALSAAVVGGTADLVP… |
| X6NGA3 | 89-219 | TQPTYFLTRIVILQGFLVLHMIAFLTAFFQWEGCFGNRGILPVQNYLELLLSSNNSQSRPSLVLYLDDCPTLLWLFPLRHSSAAMKW… |
| A0A2N9NLQ3 | 140-276 | None |
| A0A218UBD8 | 9-141 | None |
| A0A674HVW9 | 336-469 | None |
| A0A1X7TSB1 | 39-184 | None |
| D3AZA0 | 39-172 | None |
| A0A267DGV4 | 7-138 | None |
| X6M7T0 | 1-166 | None |
| A0A6B1KX58 | 15-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.