DPCstruct | MC16546
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 130 ± 26 aa |
| Standard deviation of domain lengths | 25.60 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 19.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2FJH4 | 579-677 | MYKRNAMVSRLGNVADVVVMLSLKYDGRSIPLHDASSAVSNSPLVKIGEDEAQESLQLLCELFPSFASIKSVERQDWLTLQRDARAV… |
| X6N6H7 | 16-113 | LQKESARWESLLYLVGLIRGIYLSEKKVSMPYEQLVEKLCKKRKDQYLTTSYEMDQQLKLLESLVCKFLTIKSGKTLKIAKIDLKVD… |
| A0A1A9VPA5 | 107-257 | None |
| H2YI24 | 209-334 | None |
| A0A0L7QXA1 | 389-522 | None |
| R7QNS9 | 428-541 | None |
| A0A7J9LRH7 | 231-369 | None |
| C5LIQ6 | 663-850 | None |
| D0NZ35 | 220-322 | None |
| A0A7I4CCP5 | 459-626 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.