DPCstruct | MC16545
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 412 ± 67 aa |
| Standard deviation of domain lengths | 66.53 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 19.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0U5G8B5 | 22-350 | SRDDFYAKITASRSSLEGFASSVRGKVRAVRESCYSMLFSMSRLREHFYGFAELPGPLSQALFKDSSHLSSHQFSVLLNISRCLIDD… |
| X6N321 | 58-483 | QRMFPILLGMMKMLNYVYTKDFNAMLGSEYQPISFAINVESLYNLLNLDFNEYKRVPADKKPTKVMTLEKIVIWLITMRDYICRFIA… |
| U9U2F5 | 46-424 | None |
| A0A7J8YLD0 | 104-540 | None |
| A0A821LXM0 | 14-498 | None |
| A0A1D2N4F8 | 590-1078 | None |
| A0A446NFT4 | 56-481 | None |
| A0A446U2T4 | 40-521 | None |
| A0A2D4HY16 | 7-370 | None |
| A0A6P4Z0V9 | 2-342 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.