DPCstruct | MC16544
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 142 ± 17 aa |
| Standard deviation of domain lengths | 17.21 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 76.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 42.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453L372 | 55-176 | MNKVLSAHFRAYIQALEKLQLDIATSTDLLGVETRSTGYLFSIGKEPLKARSSVFALGERINVLKDIEQPALIPHISEAKSQKYPYE… |
| X6N0T4 | 1-174 | MNKVYMLQFRTYIQVLSRHKEMNAAEKNDLMGMELSDKSTVVVGLFQSSKKYQNKEYLNEMFTLSKTRMALLKDFAKSTPLVTQMIE… |
| A0A446JU30 | 112-261 | None |
| A0A287FBL7 | 1-128 | None |
| A0A811MWJ6 | 3-161 | None |
| A0A1D6P8D6 | 1-157 | None |
| A0A6A4S0S4 | 295-421 | None |
| A0A0N4YZI8 | 85-214 | None |
| A0A3Q0JEL0 | 164-295 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.