DPCstruct | MC16543
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 134 ± 20 aa |
| Standard deviation of domain lengths | 19.64 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 42.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X6PFK6 | 501-642 | LWNAKIESEDEDTQMILLTWTEYDEYLQQTMEISAIWGHCIDLNLIYVLAKHNQDDINEIHEYLSDFCTWKEQKYNDKKYEEKMKEF… |
| X6N0F3 | 133-254 | YNQYIQQTMQISAMWGHSIDLNLIFVAFVYCSNRDINETFKMLFEFEEWKIRYNNQQKYKEKRDEFVKRNCCNHNINLFCMFLSKRL… |
| X6LZ33 | 358-492 | None |
| X6LNW3 | 6-121 | None |
| X6LMP0 | 4-149 | None |
| X6LLA7 | 195-344 | None |
| X6LIW5 | 9-124 | None |
| X6LCI5 | 356-520 | None |
| X6L892 | 1-103 | None |
| X6PER8 | 354-526 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.