DPCstruct | MC1654
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 162 ± 20 aa |
| Standard deviation of domain lengths | 19.56 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 70.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.68 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S3DEP9 | 3-171 | VPTMATKHSPQGPPDRAFALQKYLLLHSQQDALHKHISEISPPSPTTSRYSPSSRSSSTSSASSDPFGARSQPTLLTESPSTRPTLH… |
| A0A0M9VXB1 | 2-130 | EKTHNYTFTLQKYMLLQEQHEQLSSNLEQIRPRKSSTSSGSTVSSPATSPSRGWEDRSQEALDTIVDEDTIFKISAEEQRLFDINES… |
| A0A2L2SYM1 | 2-161 | None |
| Q871A3 | 11-198 | None |
| A0A4U0WDZ0 | 13-167 | None |
| A0A6A6UHC9 | 1-136 | None |
| A0A3D8S6N3 | 1-197 | None |
| A0A0G4L6F6 | 31-186 | None |
| A0A2T2NGA2 | 2-142 | None |
| A0A5M9JBE4 | 63-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.