DPCstruct | MC16539
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 134 ± 10 aa |
| Standard deviation of domain lengths | 9.52 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 32.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V5FV19 | 244-362 | AGVRAEGVDFKPNGEAEDFFKRRAYNMWPVDLRYNVLYKSIWDLKEGLEGGYIEDNTPLDMTLPVIDILEGAKEREEFIHRFDGAKN… |
| A0A397GCC0 | 5-148 | CPWFLVTADDLDTGHITIVEFKRNGQVRESFRRRACNMWPVYLEYCTGCRDLGQVKWDGVGGGDEKNSDLDMTQPVIDILEGAKARR… |
| A0A1L9WQ16 | 136-247 | None |
| A0A2V5IEV3 | 30-172 | None |
| A0A4Y8DEZ1 | 73-195 | None |
| A0A194W333 | 234-368 | None |
| A0A397H8C2 | 390-535 | None |
| A0A317W758 | 190-322 | None |
| A0A093Y8U6 | 289-419 | None |
| A0A5N6JA49 | 6-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.