DPCstruct | MC16538
Metacluster Properties and Pfam Annotations
| Number of structural domains | 89 |
|---|---|
| Mean domain length (aa) | 330 ± 72 aa |
| Standard deviation of domain lengths | 71.75 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 90.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 24.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03069 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q9SBM4 | 2-311 | DVIEFTPTYDEYGWNFGGTAPIRKVRPGSALKLWTDDAFAGRLRRTEDRASALIDVRYTNPQTGPFYVEGAELGDTLALHFVSIEPS… |
| V5FS44 | 492-796 | VHVGRHQKHLKWSKDEPPVLTISSGDTVTFDTIDGSNGQILEDSDISAIDSFDLGLADPVFGPVFIRDAEPGDALKIEILNLQIANW… |
| K2D5C0 | 9-285 | None |
| A0A6L7ZY73 | 133-467 | None |
| A0A7C6SBH7 | 3-250 | None |
| A0A542MX95 | 31-371 | None |
| A0A061RI18 | 42-313 | None |
| A0A5S9NBX9 | 364-778 | None |
| A0A7W5LL46 | 37-429 | None |
| A0A4S4D3R0 | 27-404 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.