DPCstruct | MC16535
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 77 ± 9 aa |
| Standard deviation of domain lengths | 9.29 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 44.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A510K4L4 | 2-83 | HAEIESLEALNENGGLKGKNITIKLEFDKNFDSKSYGRSMCGYCRSDVKNYVKKSGANSIKVYTPDGNFLWEKGMENWVQYK |
| E5BAW9 | 291-363 | HAEVGVIQQAFEKGMSQGREMTMSVSKEPVCGYCRSDIAAMADKAGLKSLTIYEETTGSVLYWQPGMKSLKIR |
| A0A3G2GI73 | 1-71 | None |
| A0A5C4PR45 | 113-198 | None |
| A0A7H9WIW5 | 104-192 | None |
| A0A807PSD8 | 104-189 | None |
| A0A2T7UGC9 | 915-991 | None |
| A0A630KPW5 | 2-64 | None |
| A0A764GPD5 | 64-139 | None |
| A0A7W3BYZ5 | 27-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.