DPCstruct | MC16534
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 104 ± 11 aa |
| Standard deviation of domain lengths | 10.94 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 24.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0FAW9 | 1-88 | MHFYRFSSKTWSAGITKYDIGGHEVKIYNIAKTIADCFKFRSKIGINVAREALKTAVREKGEKPARIMKYAKLCRVTAIVQPILEAMI |
| A0A510K350 | 9-100 | VPVGDNVSRVKSTRDNIIFKYNKKDYYNIGRTSITNPFGRKIFSYDKKRTILDIIKNKNRVDADVFSEAMKLYFRDNDRDLLKMSKY… |
| A0A134ACK1 | 21-125 | None |
| A0A645IFX2 | 1-103 | None |
| A0A2A7T1V2 | 80-196 | None |
| A0A517M7U6 | 80-180 | None |
| A0A7X5ICG9 | 48-155 | None |
| A0A8B0GP58 | 27-116 | None |
| A0A2T5IQ77 | 222-343 | None |
| A0A847CN10 | 46-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.